Pallidin (BLOC1S6) (NM_012388) Human Mass Spec Standard
CAT#: PH301514
PLDN MS Standard C13 and N15-labeled recombinant protein (NP_036520)
View other "Pallidin" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PLDN MS Standard C13 and N15-labeled recombinant protein (NP_036520) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201514 |
| Predicted MW | 19.7 kDa |
| Protein Sequence |
>RC201514 protein sequence
Red=Cloning site Green=Tags(s) MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQA LQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQ QKRQKEELEREQQREKEFEREKQLTARPAKRM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_036520 |
| RefSeq Size | 3959 |
| RefSeq ORF | 516 |
| Synonyms | BLOS6; HPS9; PA; PALLID; PLDN |
| Locus ID | 26258 |
| Cytogenetics | 15q21.1 |
| Summary | The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Mutations in this gene cause symptoms associated with Hermansky-Pudlak syndrome-9. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome. [provided by RefSeq, Aug 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402203 | BLOC1S6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402203 | Transient overexpression lysate of pallidin homolog (mouse) (PLDN) |
CNY 3080.00 |
|
| TP301514 | Recombinant protein of human pallidin homolog (mouse) (PLDN), 20 µg |
CNY 2900.00 |
其它Pallidin产品
