THEM2 (ACOT13) (NM_018473) Human Mass Spec Standard
CAT#: PH301505
ACOT13 MS Standard C13 and N15-labeled recombinant protein (NP_060943)
View other "THEM2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ACOT13 MS Standard C13 and N15-labeled recombinant protein (NP_060943) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201505 |
Predicted MW | 15 kDa |
Protein Sequence |
>RC201505 protein sequence
Red=Cloning site Green=Tags(s) MTSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTM ALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060943 |
RefSeq Size | 4118 |
RefSeq ORF | 420 |
Synonyms | HT012; PNAS-27; THEM2 |
Locus ID | 55856 |
Cytogenetics | 6p22.3 |
Summary | This gene encodes a member of the thioesterase superfamily. In humans, the protein co-localizes with microtubules and is essential for sustained cell proliferation. The orthologous mouse protein forms a homotetramer and is associated with mitochondria. The mouse protein functions as a medium- and long-chain acyl-CoA thioesterase. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413049 | ACOT13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413049 | Transient overexpression lysate of acyl-CoA thioesterase 13 (ACOT13), transcript variant 1 |
CNY 3080.00 |
|
TP301505 | Recombinant protein of human thioesterase superfamily member 2 (THEM2), 20 µg |
CNY 2900.00 |