ZDHHC4 (NM_018106) Human Mass Spec Standard
CAT＃: PH301489
ZDHHC4 MS Standard C13 and N15-labeled recombinant protein (NP_060576)
View other "ZDHHC4" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | ZDHHC4 MS Standard C13 and N15-labeled recombinant protein (NP_060576) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201489 |
| Predicted MW | 39.8 kDa |
| Protein Sequence |
>RC201489 protein sequence
Red=Cloning site Green=Tags(s) MDFLVLFLFYLASVLMGLVLICVCSKTHSLKGLARGGAQIFSCIIPECLQRAVHGLLHYLFHTRNHTFIV LHLVLQGMVYTEYTWEVFGYCQELELSLHYLLLPYLLLGVNLFFFTLTCGTNPGIITKANELLFLHVYEF DEVMFPKNVRCSTCDLRKPARSKHCSVCNWCVHRFDHHCVWVNNCIGAWNIRYFLIYVLTLTASAATVAI VSTTFLVHLVVMSDLYQETYIDDLGHLHVMDTVFLIQYLFLTFPRIVFMLGFVVVLSFLLGGYLLFVLYL AATNQTTNEWYRGDWAWCQRCPLVAWPPSAEPQVHRNIHSHGLRSNLQEIFLPAFPCHERKKQE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060576 |
| RefSeq Size | 1413 |
| RefSeq ORF | 1032 |
| Synonyms | ZNF374 |
| Locus ID | 55146 |
| Cytogenetics | 7p22.1 |
| Summary | Palmitoyltransferase that could catalyze the addition of palmitate onto protein substrates including the D(2) dopamine receptor DRD2.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402650 | ZDHHC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427411 | ZDHHC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427412 | ZDHHC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427413 | ZDHHC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402650 | Transient overexpression lysate of zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 3 |
CNY 3080.00 |
|
| LY427411 | Transient overexpression lysate of zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 1 |
CNY 3080.00 |
|
| LY427412 | Transient overexpression lysate of zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 2 |
CNY 3080.00 |
|
| LY427413 | Transient overexpression lysate of zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 4 |
CNY 3080.00 |
|
| TP301489 | Recombinant protein of human zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP761502 | Purified recombinant protein of Human zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
