Apolipoprotein O (APOO) (NM_024122) Human Mass Spec Standard
CAT#: PH301451
APOO MS Standard C13 and N15-labeled recombinant protein (NP_077027)
View other "Apolipoprotein O" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | APOO MS Standard C13 and N15-labeled recombinant protein (NP_077027) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201451 |
Predicted MW | 22.3 kDa |
Protein Sequence |
>RC201451 protein sequence
Red=Cloning site Green=Tags(s) MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHY CEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPP GFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_077027 |
RefSeq Size | 1134 |
RefSeq ORF | 594 |
Synonyms | FAM121B; Mic23; MIC26; MICOS26; My025 |
Locus ID | 79135 |
Cytogenetics | Xp22.11 |
Summary | This gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glycosylation. This protein may be involved in preventing lipid accumulation in the myocardium in obese and diabetic patients. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 4, 5, 12 and 16.[provided by RefSeq, Sep 2009] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411353 | APOO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411353 | Transient overexpression lysate of apolipoprotein O (APOO), transcript variant 1 |
CNY 3080.00 |
|
TP301451 | Recombinant protein of human apolipoprotein O (APOO), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Apolipoprotein O产品