PSF3 (GINS3) (NM_022770) Human Mass Spec Standard
CAT#: PH301425
GINS3 MS Standard C13 and N15-labeled recombinant protein (NP_073607)
View other "PSF3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | GINS3 MS Standard C13 and N15-labeled recombinant protein (NP_073607) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201425 |
| Predicted MW | 24.5 kDa |
| Protein Sequence |
>RC201425 protein sequence
Red=Cloning site Green=Tags(s) MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPL WLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQ TFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRK FTDMED myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_073607 |
| RefSeq Size | 2297 |
| RefSeq ORF | 648 |
| Synonyms | PSF3 |
| Locus ID | 64785 |
| Cytogenetics | 16q21 |
| Summary | This gene encodes a protein subunit of the GINS heterotetrameric complex, which is essential for the initiation of DNA replication and replisome progression in eukaryotes. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411561 | GINS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411561 | Transient overexpression lysate of GINS complex subunit 3 (Psf3 homolog) (GINS3), transcript variant 2 |
CNY 3080.00 |
|
| TP301425 | Recombinant protein of human GINS complex subunit 3 (Psf3 homolog) (GINS3), transcript variant 2, 20 µg |
CNY 2900.00 |
