MEIS2 (NM_002399) Human Mass Spec Standard
CAT#: PH301395
MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_002390)
View other "MEIS2" proteins (15)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_002390) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201395 |
| Predicted MW | 41.5 kDa |
| Protein Sequence |
>RC201395 protein sequence
Red=Cloning site Green=Tags(s) MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGH PLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQV LRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDD ATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRA WLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFV LDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002390 |
| RefSeq Size | 3074 |
| RefSeq ORF | 1143 |
| Synonyms | CPCMR; HsT18361; MRG1 |
| Locus ID | 4212 |
| Cytogenetics | 15q14 |
| Summary | This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406902 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406903 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC406904 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406905 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419351 | MEIS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406902 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant b |
CNY 3080.00 |
|
| LY406903 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant c |
CNY 4840.00 |
|
| LY406904 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant d |
CNY 3080.00 |
|
| LY406905 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant a |
CNY 3080.00 |
|
| LY419351 | Transient overexpression lysate of Meis homeobox 2 (MEIS2), transcript variant f |
CNY 3080.00 |
|
| PH308386 | MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_733776) |
CNY 19520.00 |
|
| PH322807 | MEIS2 MS Standard C13 and N15-labeled recombinant protein (NP_733777) |
CNY 19520.00 |
|
| TP301395 | Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant f, 20 µg |
CNY 2900.00 |
|
| TP308386 | Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant d, 20 µg |
CNY 2900.00 |
|
| TP322807 | Recombinant protein of human Meis homeobox 2 (MEIS2), transcript variant a, 20 µg |
CNY 2900.00 |

