EIF4EL3 (EIF4E2) (NM_004846) Human Mass Spec Standard
CAT#: PH301391
EIF4E2 MS Standard C13 and N15-labeled recombinant protein (NP_004837)
View other "EIF4EL3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | EIF4E2 MS Standard C13 and N15-labeled recombinant protein (NP_004837) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201391 |
| Predicted MW | 28.4 kDa |
| Protein Sequence |
>RC201391 protein sequence
Red=Cloning site Green=Tags(s) MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPG RPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLR KGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNT IMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004837 |
| RefSeq Size | 1078 |
| RefSeq ORF | 735 |
| Synonyms | 4E-LP; 4EHP; EIF4EL3; h4EHP; IF4e |
| Locus ID | 9470 |
| Cytogenetics | 2q37.1 |
| Summary | Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation (PubMed:9582349, PubMed:17368478, PubMed:25624349). Acts as a repressor of translation initiation (PubMed:22751931). In contrast to EIF4E, it is unable to bind eIF4G (EIF4G1, EIF4G2 or EIF4G3), suggesting that it acts by competing with EIF4E and block assembly of eIF4F at the cap (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
| Protein Pathways | Insulin signaling pathway, mTOR signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401518 | EIF4E2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401518 | Transient overexpression lysate of eukaryotic translation initiation factor 4E family member 2 (EIF4E2) |
CNY 3080.00 |
|
| TP301391 | Recombinant protein of human eukaryotic translation initiation factor 4E family member 2 (EIF4E2), 20 µg |
CNY 2900.00 |
其它EIF4EL3产品
