TCTA (NM_022171) Human Mass Spec Standard
CAT#: PH301387
TCTA MS Standard C13 and N15-labeled recombinant protein (NP_071503)
View other "TCTA" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TCTA MS Standard C13 and N15-labeled recombinant protein (NP_071503) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201387 |
| Predicted MW | 11.3 kDa |
| Protein Sequence |
>RC201387 protein sequence
Red=Cloning site Green=Tags(s) MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHR PGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_071503 |
| RefSeq Size | 2172 |
| RefSeq ORF | 309 |
| Locus ID | 6988 |
| Cytogenetics | 3p21.31 |
| Summary | May be required for cellular fusion during osteoclastogenesis.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411726 | TCTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411726 | Transient overexpression lysate of T-cell leukemia translocation altered gene (TCTA) |
CNY 3080.00 |
|
| TP301387 | Recombinant protein of human T-cell leukemia translocation altered gene (TCTA), 20 µg |
CNY 2900.00 |
