AP2M1 (NM_001025205) Human Mass Spec Standard
CAT#: PH301377
AP2M1 MS Standard C13 and N15-labeled recombinant protein (NP_001020376)
View other "AP2M1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | AP2M1 MS Standard C13 and N15-labeled recombinant protein (NP_001020376) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201377 |
| Predicted MW | 49.2 kDa |
| Protein Sequence |
>RC201377 representing NM_001025205
Red=Cloning site Green=Tags(s) MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTK QNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKS QHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMP ECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTT KDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENA IVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIK WVRYIGRSGIYETRC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001020376 |
| RefSeq Size | 1952 |
| RefSeq ORF | 1305 |
| Synonyms | AP50; CLAPM1; MRD60; mu2 |
| Locus ID | 1173 |
| Cytogenetics | 3q27.1 |
| Summary | This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015] |
| Protein Families | Druggable Genome |
| Protein Pathways | Endocytosis, Huntington's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418234 | AP2M1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422484 | AP2M1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418234 | Transient overexpression lysate of adaptor-related protein complex 2, mu 1 subunit (AP2M1), transcript variant 1 |
CNY 3080.00 |
|
| LY422484 | Transient overexpression lysate of adaptor-related protein complex 2, mu 1 subunit (AP2M1), transcript variant 2 |
CNY 3080.00 |
|
| TP301377 | Recombinant protein of human adaptor-related protein complex 2, mu 1 subunit (AP2M1), transcript variant 2, 20 µg |
CNY 2900.00 |
