ISCA1 (NM_030940) Human Mass Spec Standard
CAT#: PH301335
ISCA1 MS Standard C13 and N15-labeled recombinant protein (NP_112202)
View other "ISCA1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | ISCA1 MS Standard C13 and N15-labeled recombinant protein (NP_112202) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201335 |
Predicted MW | 14.2 kDa |
Protein Sequence |
>RC201335 protein sequence
Red=Cloning site Green=Tags(s) MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTK GDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_112202 |
RefSeq Size | 2012 |
RefSeq ORF | 387 |
Synonyms | HBLD2; hIscA; ISA1; MMDS5 |
Locus ID | 81689 |
Cytogenetics | 9q21.33 |
Summary | ISCA1 is a mitochondrial protein involved in the biogenesis and assembly of iron-sulfur clusters, which play a role in electron-transfer reactions (Cozar-Castellano et al., 2004 [PubMed 15262227]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410656 | ISCA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410656 | Transient overexpression lysate of iron-sulfur cluster assembly 1 homolog (S. cerevisiae) (ISCA1) |
CNY 3080.00 |
|
TP301335 | Recombinant protein of human iron-sulfur cluster assembly 1 homolog (S. cerevisiae) (ISCA1), 20 µg |
CNY 2900.00 |