PAFAH1B2 (NM_002572) Human Mass Spec Standard
CAT#: PH301313
PAFAH1B2 MS Standard C13 and N15-labeled recombinant protein (NP_002563)
View other "PAFAH1B2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PAFAH1B2 MS Standard C13 and N15-labeled recombinant protein (NP_002563) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201313 |
| Predicted MW | 25.6 kDa |
| Protein Sequence |
>RC201313 protein sequence
Red=Cloning site Green=Tags(s) MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALN FGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLL PRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLH ELIMQLLEETPEEKQTTIA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002563 |
| RefSeq Size | 4200 |
| RefSeq ORF | 687 |
| Synonyms | HEL-S-303 |
| Locus ID | 5049 |
| Cytogenetics | 11q23.3 |
| Summary | Platelet-activating factor acetylhydrolase (PAFAH) inactivates platelet-activating factor (PAF) into acetate and LYSO-PAF. This gene encodes the beta subunit of PAFAH, the other subunits are alpha and gamma. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jan 2014] |
| Protein Pathways | Ether lipid metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419243 | PAFAH1B2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419243 | Transient overexpression lysate of platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2) |
CNY 3080.00 |
|
| TP301313 | Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa (PAFAH1B2), 20 µg |
CNY 2900.00 |
|
| TP720217 | Recombinant protein of human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 2. |
CNY 1800.00 |
其它PAFAH1B2产品
