ATXN10 (NM_013236) Human Mass Spec Standard
CAT#: PH301300
ATXN10 MS Standard C13 and N15-labeled recombinant protein (NP_037368)
View other "ATXN10" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | ATXN10 MS Standard C13 and N15-labeled recombinant protein (NP_037368) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201300 |
| Predicted MW | 53.5 kDa |
| Protein Sequence |
>RC201300 protein sequence
Red=Cloning site Green=Tags(s) MAAPRPPPARLSGVMVPAPIQDLEALRALTALFKEQRNRETAPRTIFQRVLDILKKSSHAVELACRDPSQ VENLASSLQLITECFRCLRNACIECSVNQNSIRNLDTIGVAVDLILLFRELRVEQESLLTAFRCGLQFLG NIASRNEDSQSIVWVHAFPELFLSCLNHPDKKIVAYSSMILFTSLNHERMKELEENLNIAIDVIDAYQKH PESEWPFLIITDLFLKSPELVQAMFPKLNNQERVTLLDLMIAKITSDEPLTKDDIPVFLRHAELIASTFV DQCKTVLKLASEEPPDDEEALATIRLLDVLCEMTVNTELLGYLQVFPGLLERVIDLLRVIHVAGKETTNI FSNCGCVRAEGDISNVANGFKSHLIRLIGNLCYKNKDNQDKVNELDGIPLILDNCNISDSNPFLTQWVIY AIRNLTEDNSQNQDLIAKMEEQGLADASLLKKVGFEVEKKGEKLILKSTRDTPKP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_037368 |
| RefSeq Size | 3340 |
| RefSeq ORF | 1425 |
| Synonyms | E46L; HUMEEP; SCA10 |
| Locus ID | 25814 |
| Cytogenetics | 22q13.31 |
| Summary | This gene encodes a protein that may function in neuron survival, neuron differentiation, and neuritogenesis. These roles may be carried out via activation of the mitogen-activated protein kinase cascade. Expansion of an ATTCT repeat from 9-32 copies to 800-4500 copies in an intronic region of this locus has been associated with spinocerebellar ataxia, type 10. Alternatively spliced transcript variants have been described.[provided by RefSeq, Jul 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415723 | ATXN10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433029 | ATXN10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415723 | Transient overexpression lysate of ataxin 10 (ATXN10), transcript variant 1 |
CNY 3080.00 |
|
| LY433029 | Transient overexpression lysate of ataxin 10 (ATXN10), transcript variant 2 |
CNY 3080.00 |
|
| TP301300 | Recombinant protein of human ataxin 10 (ATXN10), 20 µg |
CNY 2900.00 |
|
| TP330029 | Recombinant protein of human ataxin 10 (ATXN10), transcript variant 2, 20 µg |
CNY 2900.00 |
