COMT (NM_000754) Human Mass Spec Standard
CAT#: PH301275
COMT MS Standard C13 and N15-labeled recombinant protein (NP_000745)
View other "COMT" proteins (5)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 14250.00
Specifications
| Product Data | |
| Description | COMT MS Standard C13 and N15-labeled recombinant protein (NP_000745) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC201275 | 
| Predicted MW | 20 kDa | 
| Protein Sequence | 
                 >RC201275 protein sequence 
Red=Cloning site Green=Tags(s) MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMK DKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDF LAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_000745 | 
| RefSeq Size | 2304 | 
| RefSeq ORF | 546 | 
| Synonyms | HEL-S-98n | 
| Locus ID | 1312 | 
| Cytogenetics | 22q11.21 | 
| Summary | Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. [provided by RefSeq, Sep 2008] | 
| Protein Families | Druggable Genome, Transmembrane | 
| Protein Pathways | Metabolic pathways, Tyrosine metabolism | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC400254 | COMT HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY400254 | Transient overexpression lysate of catechol-O-methyltransferase (COMT), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| PH304127 | COMT MS Standard C13 and N15-labeled recombinant protein (NP_009294) | 
                                                     CNY 19520.00  | 
                                            |
| TP301275 | Purified recombinant protein of Homo sapiens catechol-O-methyltransferase (COMT), transcript variant 1, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP304127 | Recombinant protein of human catechol-O-methyltransferase (COMT), transcript variant 4, 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
