PSME1 (NM_006263) Human Mass Spec Standard
CAT#: PH301260
PSME1 MS Standard C13 and N15-labeled recombinant protein (NP_006254)
View other "PSME1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PSME1 MS Standard C13 and N15-labeled recombinant protein (NP_006254) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201260 |
Predicted MW | 28.7 kDa |
Protein Sequence |
>RC201260 protein sequence
Red=Cloning site Green=Tags(s) MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVK EKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIP RIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYR DIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006254 |
RefSeq Size | 1023 |
RefSeq ORF | 747 |
Synonyms | HEL-S-129m; IFI5111; PA28A; PA28alpha; REGalpha |
Locus ID | 5720 |
Cytogenetics | 14q12 |
Summary | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the alpha subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three alpha and three beta subunits combine to form a heterohexameric ring. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Protein Pathways | Antigen processing and presentation, Proteasome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401886 | PSME1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401886 | Transient overexpression lysate of proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) (PSME1), transcript variant 1 |
CNY 3080.00 |
|
TP301260 | Recombinant protein of human proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) (PSME1), transcript variant 1, 20 µg |
CNY 2900.00 |