CRIP1 (NM_001311) Human Mass Spec Standard
CAT#: PH301217
CRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_001302)
View other "CRIP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_001302) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201217 |
| Predicted MW | 8.5 kDa |
| Protein Sequence |
>RC201217 protein sequence
Red=Cloning site Green=Tags(s) MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGG AESHTFK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001302 |
| RefSeq Size | 480 |
| RefSeq ORF | 231 |
| Synonyms | CRHP; CRIP; CRP-1; CRP1 |
| Locus ID | 1396 |
| Cytogenetics | 14q32.33 |
| Summary | Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhombotin-3 (RBTN3; MIM 180386). CRIP may be involved in intestinal zinc transport (Hempe and Cousins, 1991 [PubMed 1946385]).[supplied by OMIM, Mar 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420018 | CRIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420018 | Transient overexpression lysate of cysteine-rich protein 1 (intestinal) (CRIP1) |
CNY 3080.00 |
|
| TP301217 | Recombinant protein of human cysteine-rich protein 1 (intestinal) (CRIP1), 20 µg |
CNY 2900.00 |
