PSMD11 (NM_002815) Human Mass Spec Standard
CAT#: PH301201
PSMD11 MS Standard C13 and N15-labeled recombinant protein (NP_002806)
View other "PSMD11" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PSMD11 MS Standard C13 and N15-labeled recombinant protein (NP_002806) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201201 |
| Predicted MW | 47.3 kDa |
| Protein Sequence |
>RC201201 representing NM_002815
Red=Cloning site Green=Tags(s) MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLL KYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDT KRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATL DMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYA GRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHI SSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKK LT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002806 |
| RefSeq Size | 1598 |
| RefSeq ORF | 1266 |
| Synonyms | p44.5; Rpn6; S9 |
| Locus ID | 5717 |
| Cytogenetics | 17q11.2 |
| Summary | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the proteasome subunit S9 family that functions as a non-ATPase subunit of the 19S regulator and is phosphorylated by AMP-activated protein kinase. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012] |
| Protein Families | Stem cell - Pluripotency |
| Protein Pathways | Proteasome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419095 | PSMD11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419095 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 11 (PSMD11) |
CNY 3080.00 |
|
| TP301201 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 11 (PSMD11), 20 µg |
CNY 2900.00 |
