PSMA7 (NM_002792) Human Mass Spec Standard
CAT#: PH301169
PSMA7 MS Standard C13 and N15-labeled recombinant protein (NP_002783)
View other "PSMA7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PSMA7 MS Standard C13 and N15-labeled recombinant protein (NP_002783) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201169 |
| Predicted MW | 27.9 kDa |
| Protein Sequence |
>RC201169 protein sequence
Red=Cloning site Green=Tags(s) MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVC MAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDG TPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAV MRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002783 |
| RefSeq Size | 1050 |
| RefSeq ORF | 744 |
| Synonyms | C6; HEL-S-276; HSPC; RC6-1; XAPC7 |
| Locus ID | 5688 |
| Cytogenetics | 20q13.33 |
| Summary | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the peptidase T1A family that functions as a 20S core alpha subunit. The encoded protein interacts with the hepatitis B virus X protein and plays a role in regulating hepatitis C virus internal ribosome entry site (IRES) activity, an activity essential for viral replication. The encoded protein also plays a role in the cellular stress response by regulating hypoxia-inducible factor-1alpha. A pseudogene of this gene is located on the long arm of chromosome 9. [provided by RefSeq, Jul 2012] |
| Protein Families | Druggable Genome, Protease |
| Protein Pathways | Proteasome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400987 | PSMA7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400987 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7) |
CNY 3080.00 |
|
| TP301169 | Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7), 20 µg |
CNY 2900.00 |
