PPIC (NM_000943) Human Mass Spec Standard
CAT#: PH301143
PPIC MS Standard C13 and N15-labeled recombinant protein (NP_000934)
View other "PPIC" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PPIC MS Standard C13 and N15-labeled recombinant protein (NP_000934) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201143 |
| Predicted MW | 22.8 kDa |
| Protein Sequence |
>RC201143 protein sequence
Red=Cloning site Green=Tags(s) MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENF VALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPD TNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIA DW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000934 |
| RefSeq Size | 1241 |
| RefSeq ORF | 636 |
| Synonyms | CYPC |
| Locus ID | 5480 |
| Cytogenetics | 5q23.2 |
| Summary | The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase)) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. Similar to other PPIases, this protein can bind immunosuppressant cyclosporin A. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424438 | PPIC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424438 | Transient overexpression lysate of peptidylprolyl isomerase C (cyclophilin C) (PPIC) |
CNY 3080.00 |
|
| TP301143 | Recombinant protein of human peptidylprolyl isomerase C (cyclophilin C) (PPIC), 20 µg |
CNY 2900.00 |
|
| TP720190 | Recombinant protein of human peptidylprolyl isomerase C (cyclophilin C) (PPIC) |
CNY 1800.00 |
