TADA3L (TADA3) (NM_133480) Human Mass Spec Standard
CAT#: PH301082
TADA3 MS Standard C13 and N15-labeled recombinant protein (NP_597814)
View other "TADA3L" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | TADA3 MS Standard C13 and N15-labeled recombinant protein (NP_597814) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201082 |
Predicted MW | 41.4 kDa |
Protein Sequence |
>RC201082 protein sequence
Red=Cloning site Green=Tags(s) MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQI LTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPI DVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQK DGARAAAVADKKKGLMGPLTELDTKDVDALLKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPMEDS PIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQ AELKALSAHNRTKKHDLLR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_597814 |
RefSeq Size | 2846 |
RefSeq ORF | 1107 |
Synonyms | ADA3; hADA3; NGG1; STAF54; TADA3L |
Locus ID | 10474 |
Cytogenetics | 3p25.3 |
Summary | DNA-binding transcriptional activator proteins increase the rate of transcription by interacting with the transcriptional machinery bound to the basal promoter in conjunction with adaptor proteins, possibly by acetylation and destabilization of nucleosomes. The protein encoded by this gene is a transcriptional activator adaptor and a component of the histone acetyl transferase (HAT) coactivator complex which plays a crucial role in chromatin modulation and cell cycle progression. Along with the other components of the complex, this protein links transcriptional activators bound to specific promoters, to histone acetylation and the transcriptional machinery. The protein is also involved in the stabilization and activation of the p53 tumor suppressor protein that plays a role in the cellular response to DNA damage. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401911 | TADA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408813 | TADA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401911 | Transient overexpression lysate of transcriptional adaptor 3 (TADA3), transcript variant 1 |
CNY 3080.00 |
|
LY408813 | Transient overexpression lysate of transcriptional adaptor 3 (TADA3), transcript variant 2 |
CNY 3080.00 |
|
PH303687 | TADA3 MS Standard C13 and N15-labeled recombinant protein (NP_006345) |
CNY 19520.00 |
|
TP301082 | Recombinant protein of human transcriptional adaptor 3 (NGG1 homolog, yeast)-like (TADA3L), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP303687 | Recombinant protein of human transcriptional adaptor 3 (NGG1 homolog, yeast)-like (TADA3L), transcript variant 1, 20 µg |
CNY 2900.00 |