DNAJB2 (NM_006736) Human Mass Spec Standard
CAT#: PH301081
DNAJB2 MS Standard C13 and N15-labeled recombinant protein (NP_006727)
View other "DNAJB2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | DNAJB2 MS Standard C13 and N15-labeled recombinant protein (NP_006727) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201081 |
Predicted MW | 35.6 kDa |
Protein Sequence |
>RC201081 protein sequence
Red=Cloning site Green=Tags(s) MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGR EGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDLGPFSELQNRGSRHSGPFFTF SSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRITTRRIMENGQERVEVEEDGQLKSVTINGVPD DLALGLELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQ HRRQGRPKAQHQDPGLGGTQEGARGEATKRSPSPEEKASRCLIL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006727 |
RefSeq Size | 3129 |
RefSeq ORF | 972 |
Synonyms | CMT2T; DSMA5; HSJ-1; HSJ1; HSPF3 |
Locus ID | 3300 |
Cytogenetics | 2q35 |
Summary | This gene is almost exclusively expressed in the brain, mainly in the neuronal layers. It encodes a protein that shows sequence similarity to bacterial DnaJ protein and the yeast homologs. In bacteria, this protein is implicated in protein folding and protein complex dissociation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416440 | DNAJB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422070 | DNAJB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416440 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 2 |
CNY 3080.00 |
|
LY422070 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 1 |
CNY 3080.00 |
|
PH306769 | DNAJB2 MS Standard C13 and N15-labeled recombinant protein (NP_001034639) |
CNY 19520.00 |
|
TP301081 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP306769 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 2 (DNAJB2), transcript variant 1, 20 µg |
CNY 2900.00 |