CDC42EP3 (NM_006449) Human Mass Spec Standard
CAT#: PH301069
CDC42EP3 MS Standard C13 and N15-labeled recombinant protein (NP_006440)
View other "CDC42EP3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CDC42EP3 MS Standard C13 and N15-labeled recombinant protein (NP_006440) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201069 |
| Predicted MW | 27.7 kDa |
| Protein Sequence |
>RC201069 protein sequence
Red=Cloning site Green=Tags(s) MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQ EKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKL PRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTP CELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006440 |
| RefSeq Size | 5715 |
| RefSeq ORF | 762 |
| Synonyms | BORG2; CEP3; UB1 |
| Locus ID | 10602 |
| Cytogenetics | 2p22.2 |
| Summary | This gene encodes a member of a small family of guanosine triphosphate (GTP) metabolizing proteins that contain a CRIB (Cdc42, Rac interactive binding) domain. Members of this family of proteins act as effectors of CDC42 function. The encoded protein is involved in actin cytoskeleton re-organization during cell shape changes, including pseudopodia formation. A pseudogene of this gene is found on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416634 | CDC42EP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416634 | Transient overexpression lysate of CDC42 effector protein (Rho GTPase binding) 3 (CDC42EP3) |
CNY 3080.00 |
|
| TP301069 | Recombinant protein of human CDC42 effector protein (Rho GTPase binding) 3 (CDC42EP3), 20 µg |
CNY 2900.00 |
其它CDC42EP3产品
