CMTM6 (NM_017801) Human Mass Spec Standard
CAT#: PH301061
CMTM6 MS Standard C13 and N15-labeled recombinant protein (NP_060271)
View other "CMTM6" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CMTM6 MS Standard C13 and N15-labeled recombinant protein (NP_060271) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201061 |
Predicted MW | 20.4 kDa |
Protein Sequence |
>RC201061 protein sequence
Red=Cloning site Green=Tags(s) MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVVSQCTLCGGLYF FEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVF GFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060271 |
RefSeq Size | 3384 |
RefSeq ORF | 549 |
Synonyms | CKLFSF6; PRO2219 |
Locus ID | 54918 |
Cytogenetics | 3p22.3 |
Summary | This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413539 | CMTM6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413539 | Transient overexpression lysate of CKLF-like MARVEL transmembrane domain containing 6 (CMTM6) |
CNY 3080.00 |
|
TP301061 | Recombinant protein of human CKLF-like MARVEL transmembrane domain containing 6 (CMTM6), 20 µg |
CNY 2900.00 |