CEP55 (NM_018131) Human Mass Spec Standard
CAT#: PH301052
CEP55 MS Standard C13 and N15-labeled recombinant protein (NP_060601)
View other "CEP55" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | CEP55 MS Standard C13 and N15-labeled recombinant protein (NP_060601) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201052 |
| Predicted MW | 54.1 kDa |
| Protein Sequence |
>RC201052 protein sequence
Red=Cloning site Green=Tags(s) MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGKLTDKERHRLLEKIRVLEAEK EKNAYQLTEKDKEIQRLRDQLKARYSTTALLEQLEETTREGERREQVLKALSEEKDVLKQQLSAATSRIA ELESKTNTLRLSQTVAPNCFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTE TAAHSLPQQTKKPESEGYLQEEKQKCYNDLLASAKKDLEVERQTITQLSFELSEFRRKYEETQKEVHNLN QLLYSQRRADVQHLEDDRHKTEKIQKLREENDIARGKLEEEKKRSEELLSQVQFLYTSLLKQQEEQTRVA LLEQQMQACTLDFENEKLDRQHVQHQLLVILKELRKARNQITQLESLKQLHEFAITEPLVTFQGETENRE KVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCSK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060601 |
| RefSeq Size | 2656 |
| RefSeq ORF | 1392 |
| Synonyms | C10orf3; CT111; MARCH; URCC6 |
| Locus ID | 55165 |
| Cytogenetics | 10q23.33 |
| Summary | Plays a role in mitotic exit and cytokinesis (PubMed:16198290, PubMed:17853893). Recruits PDCD6IP and TSG101 to midbody during cytokinesis. Required for successful completion of cytokinesis (PubMed:17853893). Not required for microtubule nucleation (PubMed:16198290). Plays a role in the development of the brain and kidney (PubMed:28264986).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413284 | CEP55 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426692 | CEP55 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413284 | Transient overexpression lysate of centrosomal protein 55kDa (CEP55), transcript variant 1 |
CNY 3080.00 |
|
| LY426692 | Transient overexpression lysate of centrosomal protein 55kDa (CEP55), transcript variant 2 |
CNY 3080.00 |
|
| TP301052 | Recombinant protein of human centrosomal protein 55kDa (CEP55), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP761544 | Purified recombinant protein of Human centrosomal protein 55kDa (CEP55), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
