RNF181 (NM_016494) Human Mass Spec Standard
CAT#: PH301048
RNF181 MS Standard C13 and N15-labeled recombinant protein (NP_057578)
View other "RNF181" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RNF181 MS Standard C13 and N15-labeled recombinant protein (NP_057578) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201048 |
| Predicted MW | 17.9 kDa |
| Protein Sequence |
>RC201048 protein sequence
Red=Cloning site Green=Tags(s) MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGS QAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQ QHRLENLHGAMYT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057578 |
| RefSeq Size | 716 |
| RefSeq ORF | 459 |
| Synonyms | HSPC238 |
| Locus ID | 51255 |
| Cytogenetics | 2p11.2 |
| Summary | RNF181 binds the integrin alpha-IIb (ITGA2B; MIM 607759)/beta-3 (ITGB3; MIM 173470) complex and has E3 ubiquitin ligase activity (Brophy et al., 2008 [PubMed 18331836]).[supplied by OMIM, Dec 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413935 | RNF181 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413935 | Transient overexpression lysate of ring finger protein 181 (RNF181) |
CNY 3080.00 |
|
| TP301048 | Recombinant protein of human ring finger protein 181 (RNF181), 20 µg |
CNY 2900.00 |
