CENPM (NM_024053) Human Mass Spec Standard
CAT#: PH301047
CENPM MS Standard C13 and N15-labeled recombinant protein (NP_076958)
View other "CENPM" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CENPM MS Standard C13 and N15-labeled recombinant protein (NP_076958) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201047 |
Predicted MW | 19.7 kDa |
Protein Sequence |
>RC201047 protein sequence
Red=Cloning site Green=Tags(s) MSVLRPLDKLPGLNTATILLVGTEDALLQQLADSMLKEDCASELKVHLAKSLPLPSSVNRPRIDLIVFVV NLHSKYSLQNTEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEGFRA TMAQRLVRVLQICAGHVPGVSALNLLSLLRSSEGPSLEDL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_076958 |
RefSeq Size | 947 |
RefSeq ORF | 540 |
Synonyms | C22orf18; CENP-M; PANE1 |
Locus ID | 79019 |
Cytogenetics | 22q13.2 |
Summary | The protein encoded by this gene is an inner protein of the kinetochore, the multi-protein complex that binds spindle microtubules to regulate chromosome segregation during cell division. It belongs to the constitutive centromere-associated network protein group, whose members interact with outer kinetochore proteins and help to maintain centromere identity at each cell division cycle. The protein is structurally related to GTPases but cannot bind guanosine triphosphate. A point mutation that affects interaction with another constitutive centromere-associated network protein, CENP-I, impairs kinetochore assembly and chromosome alignment, suggesting that it is required for kinetochore formation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411372 | CENPM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426315 | CENPM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411372 | Transient overexpression lysate of centromere protein M (CENPM), transcript variant 1 |
CNY 3080.00 |
|
LY426315 | Transient overexpression lysate of centromere protein M (CENPM), transcript variant 3 |
CNY 3080.00 |
|
TP301047 | Recombinant protein of human centromere protein M (CENPM), transcript variant 1, 20 µg |
CNY 2900.00 |