Hsp22 (HSPB8) (NM_014365) Human Mass Spec Standard
CAT#: PH301040
HSPB8 MS Standard C13 and N15-labeled recombinant protein (NP_055180)
View other "Hsp22" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | HSPB8 MS Standard C13 and N15-labeled recombinant protein (NP_055180) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201040 |
| Predicted MW | 21.6 kDa |
| Protein Sequence |
>RC201040 protein sequence
Red=Cloning site Green=Tags(s) MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVP RGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFT KKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055180 |
| RefSeq Size | 2056 |
| RefSeq ORF | 588 |
| Synonyms | CMT2L; DHMN2; E2IG1; H11; HMN2; HMN2A; HSP22 |
| Locus ID | 26353 |
| Cytogenetics | 12q24.23 |
| Summary | The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415329 | HSPB8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415329 | Transient overexpression lysate of heat shock 22kDa protein 8 (HSPB8) |
CNY 3080.00 |
|
| TP301040 | Recombinant protein of human heat shock 22kDa protein 8 (HSPB8), 20 µg |
CNY 2900.00 |
|
| TP721206 | Purified recombinant protein of Human heat shock 22kDa protein 8 (HSPB8) |
CNY 1800.00 |
