CCDC56 (COA3) (NM_001040431) Human Mass Spec Standard
CAT#: PH301034
CCDC56 MS Standard C13 and N15-labeled recombinant protein (NP_001035521)
View other "CCDC56" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CCDC56 MS Standard C13 and N15-labeled recombinant protein (NP_001035521) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201034 |
Predicted MW | 11.7 kDa |
Protein Sequence |
>RC201034 protein sequence
Red=Cloning site Green=Tags(s) MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLA IYGYTFYSISQERFLDELEDEAKAARARALARASGS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001035521 |
RefSeq Size | 808 |
RefSeq ORF | 318 |
Synonyms | CCDC56; COX25; HSPC009; MC4DN14; MITRAC12 |
Locus ID | 28958 |
Cytogenetics | 17q21.2 |
Summary | This gene encodes a member of the cytochrome c oxidase assembly factor family. Studies of a related gene in fly suggest that the encoded protein is localized to mitochondria and is essential for cytochrome c oxidase function. [provided by RefSeq, Nov 2012] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421751 | COA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421751 | Transient overexpression lysate of coiled-coil domain containing 56 (CCDC56) |
CNY 3080.00 |
|
TP301034 | Recombinant protein of human coiled-coil domain containing 56 (CCDC56), 20 µg |
CNY 2900.00 |