ZNF593 (NM_015871) Human Mass Spec Standard
CAT#: PH301028
ZNF593 MS Standard C13 and N15-labeled recombinant protein (NP_056955)
View other "ZNF593" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ZNF593 MS Standard C13 and N15-labeled recombinant protein (NP_056955) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201028 |
Predicted MW | 13.2 kDa |
Protein Sequence |
>RC201028 protein sequence
Red=Cloning site Green=Tags(s) MKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKR LKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056955 |
RefSeq Size | 653 |
RefSeq ORF | 348 |
Synonyms | ZT86 |
Locus ID | 51042 |
Cytogenetics | 1p36.11 |
Summary | Negatively modulates the DNA binding activity of Oct-2 and therefore its transcriptional regulatory activity. Could act either by binding to DNA octamer or by interacting with Oct-2. May also be a modulator of other octamer-binding proteins.[UniProtKB/Swiss-Prot Function] |
Protein Families | Stem cell - Pluripotency, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414341 | ZNF593 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414341 | Transient overexpression lysate of zinc finger protein 593 (ZNF593) |
CNY 3080.00 |
|
TP301028 | Recombinant protein of human zinc finger protein 593 (ZNF593), 20 µg |
CNY 2900.00 |