WT1-AS (NM_015855) Human Mass Spec Standard
CAT#: PH301018
WIT1 MS Standard C13 and N15-labeled recombinant protein (NP_056939)
View other "WIT1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | WIT1 MS Standard C13 and N15-labeled recombinant protein (NP_056939) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201018 |
Predicted MW | 9.9 kDa |
Protein Sequence |
>RC201018 representing NM_015855
Red=Cloning site Green=Tags(s) MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQP QPQGPVRTPGPPSGSHPAAADN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056939 |
RefSeq Size | 1962 |
RefSeq ORF | 276 |
Synonyms | WIT-1, dJ74J1.1, MGC120207, MGC120208, MGC120209 |
Locus ID | 51352 |
Cytogenetics | 11p13 |
Summary | This gene is located upstream of the Wilms tumor 1 (WT1) gene; these two genes are bi-directionally transcribed from the same promoter region. This gene is imprinted in kidney, with preferential expression from the paternal allele. Imprinting defects at chromosome 11p13 may contribute to tumorigenesis. [provided by RefSeq, May 2014] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414347 | WIT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414347 | Transient overexpression lysate of Wilms tumor upstream neighbor 1 (WIT1) |
CNY 3080.00 |
|
TP301018 | Recombinant protein of human Wilms tumor upstream neighbor 1 (WIT1), 20 µg |
CNY 2900.00 |