NUDT9 (NM_198038) Human Mass Spec Standard
CAT＃: PH300952
NUDT9 MS Standard C13 and N15-labeled recombinant protein (NP_932155)
View other "NUDT9" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | NUDT9 MS Standard C13 and N15-labeled recombinant protein (NP_932155) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200952 |
| Predicted MW | 39.1 kDa |
| Protein Sequence |
>RC200952 protein sequence
Red=Cloning site Green=Tags(s) MAGRLLGKALAAVSLSLALASVTIRSSRCRGIQAFRNSFSSSWFHLNTNVMSGSNGSKENSHNKARTSPY PGSKVERSQVPNEKVGWLVEWQDYKPVEYTAVSVLAGPRWADPQISESNFSPKFNEKDGHVERKSKNGLY EIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKRDSSGNKIMHPVSGKHILQFVAIKRKDCGEW AIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHLVIYKGYVDDPRNTDNAWM ETEAVNYHDETGEIMDNLMLEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHAL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_932155 |
| RefSeq Size | 2458 |
| RefSeq ORF | 1050 |
| Synonyms | NUDT10 |
| Locus ID | 53343 |
| Cytogenetics | 4q22.1 |
| Summary | The protein encoded by this gene belongs to the Nudix hydrolase family. Nudix boxes are found in a family of diverse enzymes that catalyze the hydrolysis of nucleoside diphosphate derivatives. This enzyme is an ADP-ribose pyrophosphatase that catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P. It requires divalent metal ions and an intact Nudix motif for enzymatic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
| Protein Families | Druggable Genome, Ion Channels: Other |
| Protein Pathways | Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402975 | NUDT9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405100 | NUDT9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402975 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1 |
CNY 3080.00 |
|
| LY405100 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3 |
CNY 3080.00 |
|
| PH322894 | NUDT9 MS Standard C13 and N15-labeled recombinant protein (NP_076952) |
CNY 19520.00 |
|
| TP300952 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP322894 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, 20 µg |
CNY 2900.00 |
