DARPP32 (PPP1R1B) (NM_181505) Human Mass Spec Standard
CAT#: PH300916
PPP1R1B MS Standard C13 and N15-labeled recombinant protein (NP_852606)
View other "DARPP32" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PPP1R1B MS Standard C13 and N15-labeled recombinant protein (NP_852606) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200916 |
| Predicted MW | 18.7 kDa |
| Protein Sequence |
>RC200916 protein sequence
Red=Cloning site Green=Tags(s) MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEED ELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDG GSEDQVEDPALSEPGEEPQRPSPSEPGT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_852606 |
| RefSeq Size | 1530 |
| RefSeq ORF | 504 |
| Synonyms | DARPP-32; DARPP32 |
| Locus ID | 84152 |
| Cytogenetics | 17q12 |
| Summary | This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403149 | PPP1R1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405677 | PPP1R1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403149 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 1 |
CNY 3080.00 |
|
| LY405677 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 2 |
CNY 3080.00 |
|
| PH312689 | PPP1R1B MS Standard C13 and N15-labeled recombinant protein (NP_115568) |
CNY 19520.00 |
|
| TP300916 | Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP312689 | Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 1, 20 µg |
CNY 2900.00 |
其它DARPP32产品
