SSU72 (NM_014188) Human Mass Spec Standard
CAT#: PH300900
SSU72 MS Standard C13 and N15-labeled recombinant protein (NP_054907)
View other "SSU72" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | SSU72 MS Standard C13 and N15-labeled recombinant protein (NP_054907) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200900 |
| Predicted MW | 22.6 kDa |
| Protein Sequence |
>RC200900 protein sequence
Red=Cloning site Green=Tags(s) MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLR KDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVD IQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_054907 |
| RefSeq Size | 1319 |
| RefSeq ORF | 582 |
| Synonyms | HSPC182; PNAS-120 |
| Locus ID | 29101 |
| Cytogenetics | 1p36.33 |
| Summary | Protein phosphatase that catalyzes the dephosphorylation of the C-terminal domain of RNA polymerase II. Plays a role in RNA processing and termination. Plays a role in pre-mRNA polyadenylation via its interaction with SYMPK.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415450 | SSU72 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415450 | Transient overexpression lysate of SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) (SSU72) |
CNY 3080.00 |
|
| TP300900 | Recombinant protein of human SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) (SSU72), 20 µg |
CNY 2900.00 |
