OTUD5 (NM_017602) Human Mass Spec Standard
CAT＃: PH300893
OTUD5 MS Standard C13 and N15-labeled recombinant protein (NP_060072)
View other "OTUD5" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
Specifications
| Product Data | |
| Description | OTUD5 MS Standard C13 and N15-labeled recombinant protein (NP_060072) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200893 |
| Predicted MW | 60.4 kDa |
| Protein Sequence |
>RC200893 representing NM_017602
Red=Cloning site Green=Tags(s) MTILPKKKPPPPDADPANEPPPPGPMPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGARPRASPPPQGP LPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAAAAGVGAAGVVVGVGGAVGVG GCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDK KGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHG NHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGL GLPSFKPGFAEQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQ VRGPSQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPGTVLALAKPPSP CAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASVLAVSQQEYLDSMKKN KVHRDPPPDKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060072 |
| RefSeq Size | 2759 |
| RefSeq ORF | 1713 |
| Synonyms | DUBA; MCAND |
| Locus ID | 55593 |
| Cytogenetics | Xp11.23 |
| Summary | This gene encodes a member of the OTU (ovarian tumor) domain-containing cysteine protease superfamily. The OTU domain confers deubiquitinase activity and the encoded protein has been shown to suppress the type I interferon-dependent innate immune response by cleaving the polyubiquitin chain from an essential type I interferon adaptor protein. Cleavage results in disassociation of the adaptor protein from a downstream signaling complex and disruption of the type I interferon signaling cascade. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Oct 2008] |
| Protein Families | Protease |
| Protein Pathways | RIG-I-like receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413689 | OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427830 | OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427831 | OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427832 | OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413689 | Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 1 |
CNY 3080.00 |
|
| LY427830 | Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 2 |
CNY 3080.00 |
|
| LY427831 | Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 3 |
CNY 3080.00 |
|
| LY427832 | Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 4 |
CNY 3080.00 |
|
| TP300893 | Recombinant protein of human OTU domain containing 5 (OTUD5), transcript variant 1, 20 µg |
CNY 2900.00 |
