OTUD5 (NM_017602) Human Mass Spec Standard
CAT#: PH300893
OTUD5 MS Standard C13 and N15-labeled recombinant protein (NP_060072)
View other "OTUD5" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | OTUD5 MS Standard C13 and N15-labeled recombinant protein (NP_060072) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200893 |
Predicted MW | 60.4 kDa |
Protein Sequence |
>RC200893 representing NM_017602
Red=Cloning site Green=Tags(s) MTILPKKKPPPPDADPANEPPPPGPMPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGARPRASPPPQGP LPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAAAAGVGAAGVVVGVGGAVGVG GCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDK KGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHG NHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGL GLPSFKPGFAEQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQ VRGPSQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPGTVLALAKPPSP CAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASVLAVSQQEYLDSMKKN KVHRDPPPDKS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060072 |
RefSeq Size | 2759 |
RefSeq ORF | 1713 |
Synonyms | DUBA; MCAND |
Locus ID | 55593 |
Cytogenetics | Xp11.23 |
Summary | This gene encodes a member of the OTU (ovarian tumor) domain-containing cysteine protease superfamily. The OTU domain confers deubiquitinase activity and the encoded protein has been shown to suppress the type I interferon-dependent innate immune response by cleaving the polyubiquitin chain from an essential type I interferon adaptor protein. Cleavage results in disassociation of the adaptor protein from a downstream signaling complex and disruption of the type I interferon signaling cascade. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Oct 2008] |
Protein Families | Protease |
Protein Pathways | RIG-I-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413689 | OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427830 | OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427831 | OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427832 | OTUD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413689 | Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 1 |
CNY 3080.00 |
|
LY427830 | Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 2 |
CNY 3080.00 |
|
LY427831 | Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 3 |
CNY 3080.00 |
|
LY427832 | Transient overexpression lysate of OTU domain containing 5 (OTUD5), transcript variant 4 |
CNY 3080.00 |
|
TP300893 | Recombinant protein of human OTU domain containing 5 (OTUD5), transcript variant 1, 20 µg |
CNY 2900.00 |