C11orf73 (HIKESHI) (NM_016401) Human Mass Spec Standard
CAT#: PH300866
C11orf73 MS Standard C13 and N15-labeled recombinant protein (NP_057485)
View other "C11orf73" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | C11orf73 MS Standard C13 and N15-labeled recombinant protein (NP_057485) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200866 |
Predicted MW | 21.6 kDa |
Protein Sequence |
>RC200866 protein sequence
Red=Cloning site Green=Tags(s) MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLL GFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQ FTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057485 |
RefSeq Size | 1187 |
RefSeq ORF | 591 |
Synonyms | C11orf73; HLD13; HSPC138; HSPC179; L7RN6; OPI10 |
Locus ID | 51501 |
Cytogenetics | 11q14.2 |
Summary | This gene encodes an evolutionarily conserved nuclear transport receptor that mediates heat-shock-induced nuclear import of 70 kDa heat-shock proteins (Hsp70s) through interactions with FG-nucleoporins. The protein mediates transport of the ATP form but not the ADP form of Hsp70 proteins under conditions of heat shock stress. Structural analyses demonstrate that the protein forms an asymmetric homodimer and that the N-terminal domain consists of a jelly-roll/beta-sandwich fold structure that contains hydrophobic pockets involved in FG-nucleoporin recognition. Reduction of RNA expression levels in HeLa cells using small interfering RNAs results in inhibition of heat shock-induced nuclear accumulation of Hsp70s, indicating a role for this gene in regulation of Hsp70 nuclear import during heat shock stress. [provided by RefSeq, Apr 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413999 | C11orf73 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413999 | Transient overexpression lysate of chromosome 11 open reading frame 73 (C11orf73), transcript variant 1 |
CNY 3080.00 |
|
TP300866 | Recombinant protein of human chromosome 11 open reading frame 73 (C11orf73), transcript variant 1, 20 µg |
CNY 2900.00 |
其它C11orf73产品