RMND5B (NM_022762) Human Mass Spec Standard
CAT#: PH300863
RMND5B MS Standard C13 and N15-labeled recombinant protein (NP_073599)
View other "RMND5B" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RMND5B MS Standard C13 and N15-labeled recombinant protein (NP_073599) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200863 |
| Predicted MW | 44.4 kDa |
| Protein Sequence |
>RC200863 protein sequence
Red=Cloning site Green=Tags(s) MEQCACVERELDKVLQKFLTYGQHCERSLEELLHYVGQLRAELASAALQGTPLSATLSLVMSQCCRKIKD TVQKLASDHKDIHSSVSRVGKAIDRNFDSEICGVVSDAVWDAREQQQQILQMAIVEHLYQQGMLSVAEEL CQESTLNVDLDFKQPFLELNRILEALHEQDLGPALEWAVSHRQRLLELNSSLEFKLHRLHFIRLLAGGPA KQLEALSYARHFQPFARLHQREIQVMMGSLVYLRLGLEKSPYCHLLDSSHWAEICETFTRDACSLLGLSV ESPLSVSFASGCVALPVLMNIKAVIEQRQCTGVWNHKDELPIEIELGMKCWYHSVFACPILRQQTSDSNP PIKLICGHVISRDALNKLINGGKLKCPYCPMEQNPADGKRIIF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_073599 |
| RefSeq Size | 1984 |
| RefSeq ORF | 1179 |
| Synonyms | GID2; GID2B |
| Locus ID | 64777 |
| Cytogenetics | 5q35.3 |
| Summary | Core component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1. MAEA and RMND5A are both required for catalytic activity of the CTLH E3 ubiquitin-protein ligase complex (PubMed:29911972). Catalytic activity of the complex is required for normal cell proliferation (PubMed:29911972). The CTLH E3 ubiquitin-protein ligase complex is not required for the degradation of enzymes involved in gluconeogenesis, such as FBP1 (PubMed:29911972).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Stem cell - Pluripotency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411580 | RMND5B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411580 | Transient overexpression lysate of required for meiotic nuclear division 5 homolog B (S. cerevisiae) (RMND5B) |
CNY 3080.00 |
|
| TP300863 | Recombinant protein of human required for meiotic nuclear division 5 homolog B (S. cerevisiae) (RMND5B), 20 µg |
CNY 2900.00 |
