robld3 (LAMTOR2) (NM_014017) Human Mass Spec Standard
CAT#: PH300862
ROBLD3 MS Standard C13 and N15-labeled recombinant protein (NP_054736)
View other "robld3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ROBLD3 MS Standard C13 and N15-labeled recombinant protein (NP_054736) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200862 |
Predicted MW | 13.5 kDa |
Protein Sequence |
>RC200862 protein sequence
Red=Cloning site Green=Tags(s) MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLK FILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_054736 |
RefSeq Size | 699 |
RefSeq ORF | 375 |
Synonyms | ENDAP; HSPC003; MAPBPIP; MAPKSP1AP; p14; Ragulator2; ROBLD3 |
Locus ID | 28956 |
Cytogenetics | 1q22 |
Summary | The product of this gene is highly conserved with a mouse protein associated with the cytoplasmic face of late endosomes and lysosomes. The mouse protein interacts with MAPK scaffold protein 1, a component of the mitogen-activated protein kinase pathway. In humans, a mutation in this gene has been associated with a primary immunodeficiency syndrome, and suggests a role for this protein in endosomal biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415522 | LAMTOR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415522 | Transient overexpression lysate of roadblock domain containing 3 (ROBLD3), transcript variant 1 |
CNY 3080.00 |
|
TP300862 | Recombinant protein of human roadblock domain containing 3 (ROBLD3), transcript variant 1, 20 µg |
CNY 2900.00 |