URM1 (NM_030914) Human Mass Spec Standard
CAT#: PH300854
URM1 MS Standard C13 and N15-labeled recombinant protein (NP_112176)
View other "URM1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | URM1 MS Standard C13 and N15-labeled recombinant protein (NP_112176) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200854 |
Predicted MW | 11.4 kDa |
Protein Sequence |
>RC200854 protein sequence
Red=Cloning site Green=Tags(s) MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVL INDADWELLGELDYQLQDQDSVLFISTLHGG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_112176 |
RefSeq Size | 2650 |
RefSeq ORF | 303 |
Synonyms | C9orf74 |
Locus ID | 81605 |
Cytogenetics | 9q34.11 |
Summary | Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. Also acts as a ubiquitin-like protein (UBL) that is covalently conjugated via an isopeptide bond to lysine residues of target proteins such as MOCS3, ATPBD3, CTU2, USP15 and CAS. The thiocarboxylated form serves as substrate for conjugation and oxidative stress specifically induces the formation of UBL-protein conjugates.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410664 | URM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410664 | Transient overexpression lysate of ubiquitin related modifier 1 homolog (S. cerevisiae) (URM1), transcript variant 1 |
CNY 3080.00 |
|
TP300854 | Recombinant protein of human ubiquitin related modifier 1 homolog (S. cerevisiae) (URM1), transcript variant 1, 20 µg |
CNY 2900.00 |