HSCB (NM_172002) Human Mass Spec Standard
CAT#: PH300843
HSCB MS Standard C13 and N15-labeled recombinant protein (NP_741999)
View other "HSCB" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | HSCB MS Standard C13 and N15-labeled recombinant protein (NP_741999) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200843 |
Predicted MW | 27.2 kDa |
Protein Sequence |
>RC200843 representing NM_172002
Red=Cloning site Green=Tags(s) MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPT RDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLY LLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEE AKEILTKMRYFSNIEEKIKLKKIPL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_741999 |
RefSeq Size | 1106 |
RefSeq ORF | 705 |
Synonyms | DNAJC20; HSC20; JAC1 |
Locus ID | 150274 |
Cytogenetics | 22q12.1 |
Summary | This gene encodes a DnaJ-type co-chaperone and member of the heat shock cognate B (HscB) family of proteins. The encoded protein plays a role in the synthesis of iron-sulfur clusters, protein cofactors that are involved in the redox reactions of mitochondrial electron transport and other processes. Cells in which this gene is knocked down exhibit reduced activity of iron-sulfur cluster-dependent enzymes including succinate dehydrogenase and aconitase. The encoded protein may stimulate the ATPase activity of the mitochondrial stress-70 protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406803 | HSCB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406803 | Transient overexpression lysate of HscB iron-sulfur cluster co-chaperone homolog (E. coli) (HSCB) |
CNY 3080.00 |
|
TP300843 | Recombinant protein of human HscB iron-sulfur cluster co-chaperone homolog (E. coli) (HSCB), 20 µg |
CNY 2900.00 |