KCTD15 (NM_024076) Human Mass Spec Standard
CAT#: PH300838
KCTD15 MS Standard C13 and N15-labeled recombinant protein (NP_076981)
View other "KCTD15" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | KCTD15 MS Standard C13 and N15-labeled recombinant protein (NP_076981) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200838 |
| Predicted MW | 26.5 kDa |
| Protein Sequence |
>RC200838 protein sequence
Red=Cloning site Green=Tags(s) MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGSHMYTSS LATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARY YQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWN QDPTHVIRFPLNGYCRLNSVQDVL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_076981 |
| RefSeq Size | 4935 |
| RefSeq ORF | 702 |
| Locus ID | 79047 |
| Cytogenetics | 19q13.11 |
| Summary | During embryonic development, interferes with neural crest formation (By similarity). Inhibits AP2 transcriptional activity by interaction with its activation domain.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Ion Channels: Other |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411332 | KCTD15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411332 | Transient overexpression lysate of potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1 |
CNY 3080.00 |
|
| PH325391 | KCTD15 MS Standard C13 and N15-labeled recombinant protein (NP_001123466) |
CNY 14250.00 |
|
| TP300838 | Recombinant protein of human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325391 | Purified recombinant protein of Homo sapiens potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2, 20 µg |
CNY 2900.00 |
