MDS028 (ITFG2) (NM_018463) Human Mass Spec Standard
CAT#: PH300818
ITFG2 MS Standard C13 and N15-labeled recombinant protein (NP_060933)
View other "MDS028" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ITFG2 MS Standard C13 and N15-labeled recombinant protein (NP_060933) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200818 |
| Predicted MW | 49.3 kDa |
| Protein Sequence |
>RC200818 protein sequence
Red=Cloning site Green=Tags(s) MRSVSYVQRVALEFSGSLFPHAICLGDVDNDTLNELVVGDTSGKVSVYKNDDSRPWLTCSCQGMLTCVGV GDVCNKGKNLLVAVSAEGWFHLFDLTPAKVLDASGHHETLIGEEQRPVFKQHIPANTKVMLISDIDGDGC RELVVGYTDRVVRAFRWEELGEGPEHLTGQLVSLKKWMLEGQVDSLSVTLGPLGLPELMVSQPGCAYAIL LCTWKKDTGSPPASEGPTDGSRETPAARDVVLHQTSGRIHNKNVSTHLIGNIKQGHGTESSGSGLFALCT LDGTLKLMEEMEEADKLLWSVQVDHQLFALEKLDVTGNGHEEVVACAWDGQTYIIDHNRTVVRFQVDENI RAFCAGLYACKEGRNSPCLVYVTFNQKIYVYWEVQLERMESTNLVKLLETKPEYHSLLQELGVDPDDLPV TRALLHQTLYHPDQPPQCAPSSLQDPT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060933 |
| RefSeq Size | 2379 |
| RefSeq ORF | 1341 |
| Synonyms | FGGAP1; MDS028 |
| Locus ID | 55846 |
| Cytogenetics | 12p13.33 |
| Summary | As part of the KICSTOR complex functions in the amino acid-sensing branch of the TORC1 signaling pathway. Recruits, in an amino acid-independent manner, the GATOR1 complex to the lysosomal membranes and allows its interaction with GATOR2 and the RAG GTPases. Functions upstream of the RAG GTPases and is required to negatively regulate mTORC1 signaling in absence of amino acids. In absence of the KICSTOR complex mTORC1 is constitutively localized to the lysosome and activated. The KICSTOR complex is also probably involved in the regulation of mTORC1 by glucose.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413041 | ITFG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413041 | Transient overexpression lysate of integrin alpha FG-GAP repeat containing 2 (ITFG2) |
CNY 3080.00 |
|
| TP300818 | Recombinant protein of human integrin alpha FG-GAP repeat containing 2 (ITFG2), 20 µg |
CNY 2900.00 |
