HSPC150 (UBE2T) (NM_014176) Human Mass Spec Standard
CAT#: PH300748
UBE2T MS Standard C13 and N15-labeled recombinant protein (NP_054895)
View other "HSPC150" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | UBE2T MS Standard C13 and N15-labeled recombinant protein (NP_054895) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200748 |
| Predicted MW | 22.5 kDa |
| Protein Sequence |
>RC200748 protein sequence
Red=Cloning site Green=Tags(s) MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRF LTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFL KNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_054895 |
| RefSeq Size | 935 |
| RefSeq ORF | 591 |
| Synonyms | FANCT; HSPC150; PIG50 |
| Locus ID | 29089 |
| Cytogenetics | 1q32.1 |
| Summary | The protein encoded by this gene catalyzes the covalent attachment of ubiquitin to protein substrates. Defects in this gene have been associated with Fanconi anemia of complementation group T. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402285 | UBE2T HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402285 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2T (putative) (UBE2T) |
CNY 3080.00 |
|
| TP300748 | Recombinant protein of human ubiquitin-conjugating enzyme E2T (putative) (UBE2T), 20 µg |
CNY 2900.00 |
|
| TP720164 | Recombinant protein of human ubiquitin-conjugating enzyme E2T (putative) (UBE2T) |
CNY 1800.00 |
其它HSPC150产品
