MAD3 (MXD3) (NM_031300) Human Mass Spec Standard
CAT#: PH300747
MXD3 MS Standard C13 and N15-labeled recombinant protein (NP_112590)
View other "MAD3" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MXD3 MS Standard C13 and N15-labeled recombinant protein (NP_112590) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200747 |
Predicted MW | 23.5 kDa |
Protein Sequence |
>RC200747 protein sequence
Red=Cloning site Green=Tags(s) MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQAPGAQDSGRSVHNELEKRRR AQLKRCLERLKQQMPLGADCARYTTLSLLRRARMHIQKLEDQEQRARQLKERLRSKQQSLQRQLEQLRGL AGAAERERLRADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGFVAGQEHSYSHGGGAWL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_112590 |
RefSeq Size | 1483 |
RefSeq ORF | 618 |
Synonyms | BHLHC13; MAD3; MYX |
Locus ID | 83463 |
Cytogenetics | 5q35.3 |
Summary | This gene encodes a member of the Myc superfamily of basic helix-loop-helix leucine zipper transcriptional regulators. The encoded protein forms a heterodimer with the cofactor MAX which binds specific E-box DNA motifs in the promoters of target genes and regulates their transcription. Disruption of the MAX-MXD3 complex is associated with uncontrolled cell proliferation and tumorigenesis. Transcript variants of this gene encoding different isoforms have been described.[provided by RefSeq, Dec 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410573 | MXD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428302 | MXD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410573 | Transient overexpression lysate of MAX dimerization protein 3 (MXD3), transcript variant 1 |
CNY 3080.00 |
|
LY428302 | Transient overexpression lysate of MAX dimerization protein 3 (MXD3), transcript variant 2 |
CNY 3080.00 |
|
TP300747 | Recombinant protein of human MAX dimerization protein 3 (MXD3), transcript variant 1, 20 µg |
CNY 2900.00 |