MAD3 (MXD3) (NM_031300) Human Mass Spec Standard
CAT#: PH300747
MXD3 MS Standard C13 and N15-labeled recombinant protein (NP_112590)
View other "MAD3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MXD3 MS Standard C13 and N15-labeled recombinant protein (NP_112590) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200747 |
| Predicted MW | 23.5 kDa |
| Protein Sequence |
>RC200747 protein sequence
Red=Cloning site Green=Tags(s) MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQAPGAQDSGRSVHNELEKRRR AQLKRCLERLKQQMPLGADCARYTTLSLLRRARMHIQKLEDQEQRARQLKERLRSKQQSLQRQLEQLRGL AGAAERERLRADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGFVAGQEHSYSHGGGAWL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_112590 |
| RefSeq Size | 1483 |
| RefSeq ORF | 618 |
| Synonyms | BHLHC13; MAD3; MYX |
| Locus ID | 83463 |
| Cytogenetics | 5q35.3 |
| Summary | This gene encodes a member of the Myc superfamily of basic helix-loop-helix leucine zipper transcriptional regulators. The encoded protein forms a heterodimer with the cofactor MAX which binds specific E-box DNA motifs in the promoters of target genes and regulates their transcription. Disruption of the MAX-MXD3 complex is associated with uncontrolled cell proliferation and tumorigenesis. Transcript variants of this gene encoding different isoforms have been described.[provided by RefSeq, Dec 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410573 | MXD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428302 | MXD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410573 | Transient overexpression lysate of MAX dimerization protein 3 (MXD3), transcript variant 1 |
CNY 3080.00 |
|
| LY428302 | Transient overexpression lysate of MAX dimerization protein 3 (MXD3), transcript variant 2 |
CNY 3080.00 |
|
| TP300747 | Recombinant protein of human MAX dimerization protein 3 (MXD3), transcript variant 1, 20 µg |
CNY 2900.00 |
