EEF1B2 (NM_021121) Human Mass Spec Standard
CAT#: PH300733
EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_066944)
View other "EEF1B2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_066944) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200733 |
| Predicted MW | 24.8 kDa |
| Protein Sequence |
>RC200733 protein sequence
Red=Cloning site Green=Tags(s) MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLP GVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKS SILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAF EDYVQSMDVAAFNKI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_066944 |
| RefSeq Size | 854 |
| RefSeq ORF | 675 |
| Synonyms | EEF1B; EEF1B1; EF1B |
| Locus ID | 1933 |
| Cytogenetics | 2q33.3 |
| Summary | This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400721 | EEF1B2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC412075 | EEF1B2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421974 | EEF1B2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400721 | Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1 |
CNY 3080.00 |
|
| LY412075 | Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 2 |
CNY 3080.00 |
|
| LY421974 | Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 3 |
CNY 3080.00 |
|
| PH309768 | EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_001032752) |
CNY 19520.00 |
|
| PH321264 | EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_001950) |
CNY 19520.00 |
|
| TP300733 | Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP309768 | Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP321264 | Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1, 20 µg |
CNY 2900.00 |
