RAB8A (NM_005370) Human Mass Spec Standard
CAT#: PH300675
RAB8A MS Standard C13 and N15-labeled recombinant protein (NP_005361)
View other "RAB8A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | RAB8A MS Standard C13 and N15-labeled recombinant protein (NP_005361) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200675 |
Predicted MW | 23.7 kDa |
Protein Sequence |
>RC200675 protein sequence
Red=Cloning site Green=Tags(s) MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERF RTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLA LDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005361 |
RefSeq Size | 2194 |
RefSeq ORF | 621 |
Synonyms | MEL; RAB8 |
Locus ID | 4218 |
Cytogenetics | 19p13.11 |
Summary | The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417348 | RAB8A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417348 | Transient overexpression lysate of RAB8A, member RAS oncogene family (RAB8A) |
CNY 3080.00 |
|
TP300675 | Recombinant protein of human RAB8A, member RAS oncogene family (RAB8A), 20 µg |
CNY 2900.00 |