Syntaxin 3 (STX3) (NM_004177) Human Mass Spec Standard
CAT#: PH300658
STX3 MS Standard C13 and N15-labeled recombinant protein (NP_004168)
View other "Syntaxin 3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | STX3 MS Standard C13 and N15-labeled recombinant protein (NP_004168) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200658 |
| Predicted MW | 33.2 kDa |
| Protein Sequence |
>RC200658 protein sequence
Red=Cloning site Green=Tags(s) MKDRLEQLKAKQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPE PKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVD FRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKDIVRLESSIKE LHDMFMDIAMLVENQGEMLDNIELNVMHTVDHVEKARDETKKAVKYQSQARKKLIIIIVLVVVLLGILAL IIGLSVGLN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004168 |
| RefSeq Size | 6498 |
| RefSeq ORF | 867 |
| Synonyms | STX3A |
| Locus ID | 6809 |
| Cytogenetics | 11q12.1 |
| Summary | The gene is a member of the syntaxin family. The encoded protein is targeted to the apical membrane of epithelial cells where it forms clusters and is important in establishing and maintaining polarity necessary for protein trafficking involving vesicle fusion and exocytosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency, Transmembrane |
| Protein Pathways | SNARE interactions in vesicular transport |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418166 | STX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432811 | STX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418166 | Transient overexpression lysate of syntaxin 3 (STX3) |
CNY 3080.00 |
|
| LY432811 | Transient overexpression lysate of syntaxin 3 (STX3), transcript variant 2 |
CNY 3080.00 |
|
| TP300658 | Recombinant protein of human syntaxin 3 (STX3), 20 µg |
CNY 2900.00 |
其它Syntaxin 3产品
