ICAM4 (NM_001039132) Human Mass Spec Standard
CAT＃: PH300636
ICAM4 MS Standard C13 and N15-labeled recombinant protein (NP_001034221)
View other "ICAM4" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | ICAM4 MS Standard C13 and N15-labeled recombinant protein (NP_001034221) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200636 |
| Predicted MW | 29.6 kDa |
| Protein Sequence |
>RC200636 protein sequence
Red=Cloning site Green=Tags(s) MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCS NSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGG DPEAWKPGHLFRKPGALHRPGSGQRDLDLRVCCWTPRLLAARDLPRAPQSRRPGGPQQLGTHYTDARLEP RAHSFGLRFHRCPCRDPPHCGRCVPMQVPSYEVPGVKGDVLCRLSEKKRNMKQSGEMAIHGG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001034221 |
| RefSeq Size | 1277 |
| RefSeq ORF | 816 |
| Synonyms | CD242; LW |
| Locus ID | 3386 |
| Cytogenetics | 19p13.2 |
| Summary | This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. This ICAM protein contains 2 Ig-like C2-type domains and binds to the leukocyte adhesion LFA-1 protein. The molecular basis of the LW(A)/LW(B) blood group antigens is a single aa variation at position 100; Gln-100=LW(A) and Arg-100=LW(B). Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411697 | ICAM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419874 | ICAM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422020 | ICAM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411697 | Transient overexpression lysate of intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 2 |
CNY 3080.00 |
|
| LY419874 | Transient overexpression lysate of intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 1 |
CNY 3080.00 |
|
| LY422020 | Transient overexpression lysate of intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 3 |
CNY 3080.00 |
|
| TP300636 | Recombinant protein of human intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP761371 | Purified recombinant protein of Human intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) (ICAM4), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
