TMSB15A (NM_021992) Human Mass Spec Standard

Specifications

Product Data
Description	TMSB15A MS Standard C13 and N15-labeled recombinant protein (NP_068832)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC200632
Predicted MW	5.2 kDa
Protein Sequence	Sequence Link (showhide) >RC200632 protein sequence Red=Cloning site Green=Tags(s) MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS myc-FLAG tag
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_068832
RefSeq Size	666
RefSeq ORF	135
Synonyms	Tb15; TbNB; TMSB15; TMSB15B; TMSL8; TMSNB
Locus ID	11013
Cytogenetics	Xq22.1

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.