ESE1 (ELF3) (NM_004433) Human Mass Spec Standard
CAT#: PH300631
ELF3 MS Standard C13 and N15-labeled recombinant protein (NP_004424)
View other "ESE1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | ELF3 MS Standard C13 and N15-labeled recombinant protein (NP_004424) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200631 |
| Predicted MW | 41.5 kDa |
| Protein Sequence |
>RC200631 protein sequence
Red=Cloning site Green=Tags(s) MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKT QVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWII ELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSS DSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIR DILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRL VYKFGKNSSGWKEEEVLQSRN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004424 |
| RefSeq Size | 3149 |
| RefSeq ORF | 1113 |
| Synonyms | EPR-1; ERT; ESE-1; ESX |
| Locus ID | 1999 |
| Cytogenetics | 1q32.1 |
| Summary | Transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. Acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter. Also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. Represses KRT4 promoter activity. Involved in mediating vascular inflammation. May play an important role in epithelial cell differentiation and tumorigenesis. May be a critical downstream effector of the ERBB2 signaling pathway. May be associated with mammary gland development and involution. Plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401407 | ELF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426477 | ELF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401407 | Transient overexpression lysate of E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1 |
CNY 3080.00 |
|
| LY426477 | Transient overexpression lysate of E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 2 |
CNY 3080.00 |
|
| TP300631 | Recombinant protein of human E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1, 20 µg |
CNY 2900.00 |
