FSTL1 (NM_007085) Human Mass Spec Standard
CAT#: PH300586
FSTL1 MS Standard C13 and N15-labeled recombinant protein (NP_009016)
View other "FSTL1" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | FSTL1 MS Standard C13 and N15-labeled recombinant protein (NP_009016) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200586 |
| Predicted MW | 35 kDa |
| Protein Sequence |
>RC200586 protein sequence
Red=Cloning site Green=Tags(s) MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELRRRIIQWLEAEIIPDGWFS KGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENAD WKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTE EEMTRYVQELQKHQETAEKTKRVSTKEI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009016 |
| RefSeq Size | 3840 |
| RefSeq ORF | 924 |
| Synonyms | FRP; FSL1; MIR198; OCC-1; OCC1; tsc36 |
| Locus ID | 11167 |
| Cytogenetics | 3q13.33 |
| Summary | This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 10 conserved cysteine residues. This gene product is thought to be an autoantigen associated with rheumatoid arthritis. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402088 | FSTL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402088 | Transient overexpression lysate of follistatin-like 1 (FSTL1) |
CNY 3080.00 |
|
| TP300586 | Recombinant protein of human follistatin-like 1 (FSTL1), 20 µg |
CNY 2900.00 |
|
| TP720885 | Purified recombinant protein of Human follistatin-like 1 (FSTL1) |
CNY 1800.00 |
|
| TP721119 | Purified recombinant protein of Human follistatin-like 1 (FSTL1) |
CNY 1800.00 |
|
| TP721135 | Purified recombinant protein of Human follistatin-like 1 (FSTL1) |
CNY 1800.00 |
