LDOC1 (NM_012317) Human Mass Spec Standard
CAT#: PH300543
LDOC1 MS Standard C13 and N15-labeled recombinant protein (NP_036449)
View other "LDOC1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | LDOC1 MS Standard C13 and N15-labeled recombinant protein (NP_036449) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200543 |
Predicted MW | 17 kDa |
Protein Sequence |
>RC200543 protein sequence
Red=Cloning site Green=Tags(s) MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQ TASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDE EEEDDY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036449 |
RefSeq Size | 1470 |
RefSeq ORF | 438 |
Synonyms | BCUR1; Mar7; Mart7; RTL7; SIRH7 |
Locus ID | 23641 |
Cytogenetics | Xq27.1 |
Summary | The protein encoded by this gene contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. The protein localizes to the nucleus and is down-regulated in some cancer cell lines. It is thought to regulate the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB). The gene has been proposed as a tumor suppressor gene whose protein product may have an important role in the development and/or progression of some cancers. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402194 | LDOC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402194 | Transient overexpression lysate of leucine zipper, down-regulated in cancer 1 (LDOC1) |
CNY 3080.00 |
|
TP300543 | Recombinant protein of human leucine zipper, down-regulated in cancer 1 (LDOC1), 20 µg |
CNY 2900.00 |